Not for human consumption — research use only. This article is written for laboratory researchers and describes in-vitro research applications only.

Introduction

LL-37 is a 37-amino-acid cationic peptide representing the C-terminal antimicrobial domain of the human cathelicidin precursor protein hCAP-18 (UniProt P49913, encoded by the CAMP gene). In laboratory research, LL-37 is studied in microbiology and cell-culture models as a model cationic amphipathic peptide for investigating peptide–membrane interactions, and in analytical chemistry as a demanding analyte for secondary-structure and purity characterization.

This article summarizes the molecular structure of LL-37, the in-vitro laboratory models in which it is studied, and the analytical methods used to characterize reference material.

Because LL-37 sits at the intersection of peptide chemistry, membrane biophysics, and microbiology, it is also used as a benchmark analyte when laboratories validate new chromatographic or spectroscopic methods for cationic peptides. Its well-documented folding behavior and defined molecular mass make it a useful system-suitability reference in analytical methods development.

Molecular Structure

LL-37 is a linear 37-residue peptide with the sequence [LL-37, 37 aa], named for the two N-terminal leucine residues. Its average molecular mass is 4,492.9 Da (UniProt P49913). Three physicochemical features define its behavior in laboratory systems:

Cationic character. The sequence carries eleven basic residues (lysine and arginine) against five acidic residues, giving LL-37 a net positive charge of +6 at neutral pH. This charge profile drives electrostatic attraction to negatively charged surfaces — such as bacterial membrane phospholipids and lipopolysaccharides — in model membrane systems.

Amphipathic alpha-helix. In aqueous solution LL-37 is largely unstructured, but in membrane-mimetic environments (lipid micelles, trifluoroethanol/water mixtures) it adopts an amphipathic alpha-helical conformation, with hydrophobic and hydrophilic faces segregated along the helix axis. This disorder-to-helix transition was characterized by solution NMR (PDB 2K6O; Wang, J Biol Chem 2008) and makes LL-37 a standard model peptide in membrane-biophysics research.

Precursor processing context. In hCAP-18, the cathelin-like N-terminal domain is separated from the C-terminal LL-37 domain; proteolytic release of the LL-37 fragment is the activation event studied in biochemical models of cathelicidin maturation.

Laboratory Study Models

LL-37 is investigated in several standardized in-vitro systems:

• Peptide–lipid binding and membrane-interaction assays. Liposome dye-release (calcein leakage) assays, surface plasmon resonance with immobilized lipid bilayers, and isothermal titration calorimetry quantify how the peptide associates with and perturbs model membranes of defined lipid composition.
• Minimum inhibitory concentration (MIC) assay concepts. Broth microdilution MIC testing — a standardized in-vitro microbiology method — measures the lowest peptide concentration that visibly inhibits microbial growth in culture. In research use, MIC values serve as comparative potency readouts across peptide analogs and batches under identical conditions.
• Cell-culture models. Epithelial and immune cell lines are used to study peptide–cell interactions, including binding, internalization, and cytotoxicity profiling (for example, hemolysis or LDH-release assays on mammalian cells as counterscreens in selectivity research).
• Structural studies. Circular dichroism and NMR in membrane-mimetic media map the disorder-to-helix transition that underpins structure–activity analyses of LL-37 and its fragments.

These models keep experimental variables under investigator control and generate quantitative, reproducible parameters for comparing peptide variants and formulations.

Analytical Methods

Characterization of LL-37 reference standards relies on orthogonal techniques:

• Circular dichroism (CD) spectroscopy. Far-UV CD spectra (190–250 nm) report alpha-helical content; characteristic minima near 208 and 222 nm appear when LL-37 folds in trifluoroethanol or lipid environments, while aqueous buffer yields a random-coil signature. CD is the primary tool for secondary-structure verification of reference lots.
• Reversed-phase HPLC. RP-HPLC with UV detection monitors chromatographic purity. Because LL-37 is long (37 residues) and strongly basic, ion-pairing agents such as TFA and elevated column temperatures are commonly used to improve peak shape in published methods.
• Mass spectrometry. ESI-MS confirms the intact mass (4,492.9 Da average) and detects truncation or adduct species; LC-MS combines identity and purity assessment in a single run.
• Amino acid analysis. Post-hydrolysis analysis verifies the 37-residue composition against the theoretical values.

As with all long synthetic peptides, deletion sequences and diastereomers are the principal impurities monitored, and COA documentation of both purity and identity precedes use in sensitive assays.

Sample Stability and Storage Considerations

Lyophilized LL-37 reference material is stored at −20 °C or below, desiccated and protected from light. Cationic peptides are prone to adsorptive losses on glass and standard polypropylene surfaces, so laboratories commonly use low-binding tubes and minimize transfer steps when preparing analytical dilutions. Repeated freeze–thaw cycles are avoided through single-use aliquoting, and working solutions are prepared fresh because amphipathic peptides can aggregate or adsorb over time in dilute solution. All handling is documented with lot numbers and COA references to preserve traceability.

Not for human consumption — research use only. LL-37 is supplied strictly as a laboratory reference material for in-vitro research. It is not for human or veterinary use, and no medical, therapeutic, or dosing claims are made or implied in this article.

References

• UniProtKB. P49913 — Cathelicidin antimicrobial peptide (CAMP), Homo sapiens. https://www.uniprot.org/uniprotkb/P49913/entry
• RCSB Protein Data Bank. 2K6O — Human LL-37 Structure (solution NMR). https://www.rcsb.org/structure/2K6O
• Wang G. Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles. J Biol Chem. 2008;283(47):32637–32643. https://pubmed.ncbi.nlm.nih.gov/18818205/