Pramlintide is a synthetic analogue of amylin, a 37-amino-acid peptide co-secreted with insulin and reported to slow gastric emptying and promote satiety signaling. Its design replaces residues 25, 28, and 29 with proline to reduce aggregation and improve solubility relative to native amylin, making it a useful reference molecule in laboratory comparisons of amylin analogues.

Structure: pramlintide is a 37-amino-acid peptide with the sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2, with a disulfide bridge between Cys2 and Cys7 and an amidated C-terminus. Laboratory handling requires careful attention to solubility and aggregation, particularly at higher concentrations or under agitation.

Laboratory applications: cell culture and in vitro assays probing amylin receptor signaling, receptor-binding studies using amylin receptors (calcitonin receptor plus RAMP complexes), and comparative studies of amyloid formation and fibril kinetics. Pramlintide is also used as a reference compound in analytical method development, for example, HPLC and mass spectrometry workflows.

Analytical notes: store lyophilized material at -20°C in a desiccator; use freshly prepared solutions and avoid repeated freeze-thaw cycles. Document peptide source, purity, lot number, and storage conditions for all laboratory work.

Disclaimer: This material is supplied for laboratory research use only. It is not intended for human or veterinary use, not for diagnostic or therapeutic use, and not for use as a drug, food, or cosmetic. Researchers must follow institutional safety protocols and applicable regulations.

Citations: standard amylin analogue literature; receptor pharmacology reviews for calcitonin receptor / RAMP complexes; standard HPLC/MS peptide characterization methods.